PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.A01885.1.p
Common NameEUGRSUZ_A01885, LOC104441115
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family VOZ
Protein Properties Length: 444aa    MW: 49379.6 Da    PI: 5.4819
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.A01885.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ396.27.5e-1222034191217
               VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwnaa 93 
                       pppsaflgpkcalwdc+rpaq sew+ dycs++ha+lal eg pg++pvlrp+gi+lkd+ l+++l ak+qgk+vgipec+gaa +kspwna+
  Eucgr.A01885.1.p 203 PPPSAFLGPKCALWDCQRPAQRSEWCLDYCSTMHADLALSEGGPGMNPVLRPGGIGLKDDRLLSSLIAKMQGKNVGIPECHGAAIEKSPWNAS 295
                       89******************************************************************************************* PP

               VOZ  94 elfdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalalyrle 186
                       +lfdlsllege irewlffdkprrafesgnrkqrsl dysgrgwhesrkq+mke+gg+krsyymdpqp++sfewhl+eye++++ a+aly+le
  Eucgr.A01885.1.p 296 KLFDLSLLEGENIREWLFFDKPRRAFESGNRKQRSLSDYSGRGWHESRKQLMKELGGHKRSYYMDPQPPGSFEWHLFEYEVTSSGACALYKLE 388
                       ********************************************************************************************* PP

               VOZ 187 lklvdekksakgkvskdsladlqkklgrlta 217
                       lklv  kks+kgk ++ds++dlqk++ rlta
  Eucgr.A01885.1.p 389 LKLVSIKKSPKGKGMNDSVVDLQKQMRRLTA 419
                       *****************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 444 aa     Download sequence    Send to blast
MDSETKIKRE ATTQPQLSEK ARKLIDDIPE IMTNCQLAWK GGRTGDSTVL VEQLLRLLSD  60
LKAEINASSP ASPIPVDSLG SFSEEIQRML RVCDEQDDAT STLVELAGLK PAPDIEGFQI  120
TNFKTAQETD FLNFGQQGLG SQEFYQCGID LGMHNTVVND SDQLDYLHFD FHQDDEHGHY  180
GDTNNDKQIG HDFGANILPL VNPPPSAFLG PKCALWDCQR PAQRSEWCLD YCSTMHADLA  240
LSEGGPGMNP VLRPGGIGLK DDRLLSSLIA KMQGKNVGIP ECHGAAIEKS PWNASKLFDL  300
SLLEGENIRE WLFFDKPRRA FESGNRKQRS LSDYSGRGWH ESRKQLMKEL GGHKRSYYMD  360
PQPPGSFEWH LFEYEVTSSG ACALYKLELK LVSIKKSPKG KGMNDSVVDL QKQMRRLTAD  420
VSPDTKHPVK GGMKTDQKAN SEC*
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.A01885.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010052424.10.0PREDICTED: transcription factor VOZ1-like isoform X1
SwissprotQ9SGQ01e-142VOZ1_ARATH; Transcription factor VOZ1
TrEMBLA0A059DH990.0A0A059DH99_EUCGR; Uncharacterized protein
STRINGVIT_12s0028g02670.t011e-167(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM110602534
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.21e-144vascular plant one zinc finger protein